Download

Help

FASTA The FASTA format is a text-based format for representing nucleotide sequences or amino acid (protein) sequences using using single-letter coding for each nucleotide or amino acid.

Example:


					>SEQUENCE_1

					MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG

					LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK

					IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL

					MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL

The file is composed of 2 parts:
- Description line: Beginning with the ">" (greater-than) and holds a summary description of the sequence. It starts with the sequence ID that cna be followed by one or more comments
- Sequence representation: Proper representation of the sequence. It may be delivered as a single line or with multiple lines with the same number of characters.

GFF3 The GFF (General Feature Format) format consists of one line per feature, each containing 9 columns of data, plus optional track definition lines
Example:


					##gff-version 3

					ctg123 . mRNA            1300  9000  .  +  .  ID=mrna0001;Name=sonichedgehog

					ctg123 . exon            1300  1500  .  +  .  ID=exon00001;Parent=mrna0001

					ctg123 . exon            1050  1500  .  +  .  ID=exon00002;Parent=mrna0001

					ctg123 . exon            3000  3902  .  +  .  ID=exon00003;Parent=mrna0001

					ctg123 . exon            5000  5500  .  +  .  ID=exon00004;Parent=mrna0001

					ctg123 . exon            7000  9000  .  +  .  ID=exon00005;Parent=mrna0001

Fields:
1 - seqid: name of the chromosome or scaffold;
2 - source: name of the program that generated this feature, or the data source (database or project name)
3 - type: type of feature.
4 - start: Start position of the feature, with sequence numbering starting at 1.
5 - end: End position of the feature, with sequence numbering starting at 1.
6 - score: A floating point value.
7 - strand: defined as + (forward) or - (reverse).
8 - phase: One of "0", "1" or "2". "0" indicates that the first base of the feature is the first base of a codon.
9 - attributes: A semicolon-separated list of tag-value pairs, providing additional information about each feature. Some of these tags are predefined, e.g. ID, Name, Alias, Parent

▽ Data type

Gene annotation File containing the location of the gene loci and the description of their strucuture and of the associated subfeatures (ex. mRNAs, exons, CDSs, etc.).

CDSs sequences File containing the sequence of the coding portion (CDS) of the transcribed mRNAs

Functional annotation File containing the Functional annotation of the mRNAs encoded in the gene loci

Complete genome assembly File containing the integral collection of genomic sequences describing the genome of the species. It contains:
- For pseudomolecule-scale assemblies: all chromosome sequences and all unplaced sequences;
- For diploid pseudomolecule-scale assemblies: all chromosome sequences for both haplotypes and all unplaced sequences;
- For diploid draft assemblies: all sequences of primary assembly and all haplotigs sequences

Genome haplotype 1/2 File containing the collection of pseudomolecule sequences for haplotype 1 or haplotype 2 of a diploid pseudomolecule-scale assembly

Primary assembly/ Haplotigs File containing the collection of sequences for a diploid draft assembly. Nomenclature follows FalconUnzip definitions:
- Primary assembly: Assembled sequences that constitute a contiguous part of a genome regardless the variations due to the variation between haplotypes.
- Haplotigs: Contig generated by alternative paths from a portion of the associated primary assembly. The file provides the sequence of the region that, in the allele alternaive to the one represented in the primary assembly, carry a different structure.

mRNA sequences File containing the collection of sequences of the transcribed mRNA as concatenation of all the ascribed exons.

Protein sequences File containing the collection of sequences of the translated proteins from the annotated CDS sequences

Repeats annotation File containing the positional information regarding all repetitive regions (ex. transposable elements, low complexity regions, etc.)

Unplaced sequences For pseudomolecule-scale assemblies, this file collects all the assembled genomic sequences that could not be ascribed to any chromosome.